Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

2,656 – 2,670 of 1,685,317 results

2,656

Invitrogen™ VSIG4 Monoclonal Antibody (NLA14), Alexa Fluor™ 488, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Alexa Fluor 488
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	0
Isotype	IgG2a κ
Concentration	0.5 mg/mL
Antigen	VSIG4
Gene Symbols	VSIG4
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	A530061A11; BC025105; complement receptor of the immunoglobulin superfamily; CRIg; Ig superfamily protein; MGC137243 protein; protein Z39Ig; UNQ317/PRO362; V-set and immunoglobulin domain containing 4; V-set and immunoglobulin domain-containing protein 4; VSIG4; Z39IG
Gene	VSIG4
Product Type	Antibody
Gene ID (Entrez)	278180
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	NLA14

2,657

SOX2 Recombinant Rat Monoclonal Antibody (Btjce), Alexa Fluor™ Plus 555, Invitrogen™

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human,Mouse
Host Species	Rat
Conjugate	Alexa Fluor Plus 555
Applications	Flow Cytometry,Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P48431, P48432
Concentration	1.0 mg/mL
Antigen	SOX2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	ANOP3; cb236; Delta EF2a; lcc; MCOPS3; MCOPS3 (Microphthalmia Syndromic type 3); RGD1565646; sex determining region Y-box 2; SOX 2; SOX2; Sox-2; soxp; SRY (sex determining region Y) box 2; SRY (sex determining region Y)-box 2; SRY box 2; SRY related HMG box 2; SRY-box 2; SRY-box 2; SOX2; SRY-box containing gene 2; SRY-box transcription factor 2; SRY-related HMG-box gene 2; transcription factor SOX2; transcription factor SOX-2; wu:fb83g04; wu:fc14d07; ysb; zgc:65860; zgc:77389
Gene	SOX2
Product Type	Antibody
Gene ID (Entrez)	20674, 6657
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.8
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	Btjce

2,658

Invitrogen™ Phospho-Histone H3 (Ser10) Monoclonal Antibody (3HH3-4C8)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C, Avoid Freeze/Thaw Cycles
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P68431, Q71DI3
Isotype	IgG1
Concentration	Conc. Not Determined
Antigen	Phospho-Histone H3 (Ser10)
Gene Symbols	H3C1, H3C10, H3C12, H3C14, H3C15, H3C2, H3C7, HIST1H3A
Regulatory Status	RUO
Gene Alias	BUR5; CG31613; CG31613-PA; CG33803; CG33806; CG33809; CG33812; CG33815; CG33818; CG33821; CG33824; CG33827; CG33830; CG33833; CG33836; CG33839; CG33842; CG33845; CG33848; CG33851; CG33854; CG33857; CG33860; CG33863; CG33866; CG5825; CG5825-PA; CG5825-PC; CG5825-PD; CG8989; dH3.3A; Dmel\CG31613; Dmel\CG5825; Dmel_CG31613; Dmel_CG5825; fb58e10; h3; H3 histone; H3 histone family, member A; H3 histone family, member I; H3 histone family, member K; H3 histone family, member L; H3 histone family, member M; H3 histone, family 2; H3 histone, family 3A; H3 histone, family 3B; H3 histone, family 3B (H3.3B); H3 histone, family 3B.1; H3 histone, family 3C; H3.1-221; H3.1-291; H3.1-I; H3.2; H3.2-221; H3.2-614; H3.2-615; H3.2-616; h3.2a; H3.3; H3.3 histone A; H3.3 histone B; H3.3a; H3.3B; H3.5; H3.5 histone; H3.A; H3.B; H3/A; H3/b; H3/d; H3/f; H3/i; H3/j; H3/k; H3/l; H3/M; H3/n; H3/o; H3-143; H3-291; H3-3A; H3-3B; H3-5; H3-53; H3-614; H3a; H3b; H3-B; H3C1; H3c10; H3c11; H3C12; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3f; H3-F; H3F1K; H3F2; H3F3; h3f3a; H3F3A protein; H3f3b; h3f3b.1; H3F3C; h3f3d; H3FA; H3FB; H3FC HIST1H3C; H3FD; H3FF; H3FH; H3FI; H3FJ; H3FK; H3FL; H3FM; H3FN; H3g; H3h; H3i; H3L-like histone; h3r; H3S10ph; H4 clustered histone 16; H4 clustered histone 19; H4C16; H4C19; HHT1; HHT2; His3; His3.3; His3.3A; His-3.3A; His3.3A-PA; His3.3A-PC; His3.3A-PD; His3.3B; His3:CG31613; His3:CG31613-PA; His3:CG33803; His3:CG33806; His3:CG33809; His3:CG33812; His3:CG33815; His3:CG33818; His3:CG33821; His3:CG33824; His3:CG33827; His3:CG33830; His3:CG33833; His3:CG33836; His3:CG33839; His3:CG33842; His3:CG33845; His3:CG33848; His3:CG33851; His3:CG33854; His3:CG33857; His3:CG33860; His3:CG33863; His3:CG33866; Hist1; Hist1h2ai; Hist1h2ail; Hist1h2ail1; HIST1H3A; HIST1H3B; Hist1h3c; HIST1H3D; Hist1h3e; Hist1h3f; Hist1h3g; hist1h3g.L; HIST1H3H; HIST1H3I; HIST1H3J; hist2h3; HIST2H3A; Hist2h3b; HIST2H3C; Hist2h3c1; Hist2h3c2; Hist2h3c2-ps; Hist2h3ca1; Hist2h3ca2; HIST2H3D; histone; histone 1, H2ai; histone 1, H3a; histone 1, H3b; histone 1, H3f; histone 1, H3h; histone 2, H3a; histone 2, H3c; histone 2, H3c2; histone 2, H3ca2; Histone 3; histone cluster 1 H3 family member a; histone cluster 1, H2ai; histone cluster 1, H2ai-like; histone cluster 1, H2ai-like1; histone cluster 1, H3a; histone cluster 1, H3b; histone cluster 1, H3f; histone cluster 1, H3g protein L homeolog; histone cluster 1, H3h; Histone Cluster 2 H3a; histone cluster 2, H3a; histone cluster 2, H3c; histone cluster 2, H3c2; histone cluster 2, H3c2, pseudogene; histone cluster 3, H3; histone gene complex 1; histone H3; Histone H3 containing protein; histone H3.1; Histone H3.2; histone H3.2-like; histone H3.3; Histone H3.3A; Histone H3.3B; Histone H3.3C; histone H3.3C-like; histone H3.3-like protein; Histone H3.5; histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; histone H3/l; Histone H3/m; histone H3/o; histone H3-like; histone H4; histone variant H3.5; hypothetical protein LOC406269; hypothetical protein LOC550262; I79_014844; lamprey; lpy; M32461; N2749; PH3; PP781; similar to H3 histone, family 3A; SIN2; Unknown (protein for MGC:128166); wu:fa25h06; wu:fa96g06; wu:fb07a08; wu:fb36f01; wu:fb58e10; XELAEV_18028537mg; YBR010W; YBR0201; YNL031C; zgc:110292; zgc:174300; zgc:56193; zgc:56418; zgc:64222; zgc:86731
Gene	H3C1
Product Type	Antibody
Gene ID (Entrez)	126961, 333932, 8350, 8356, 8357, 8358, 8968
Formulation	Ascites with 0.05% sodium azide
Immunogen	Ovalbumin conjugated synthetic peptide (ARK[phospho-S]TGGKAPRKQLC) corresponding to aa 7-20 of histone H3.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3HH3-4C8

2,659

Invitrogen™ YKT6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	O15498
Isotype	IgG
Concentration	0.1 mg/mL
Antigen	YKT6
Gene Symbols	YKT6
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	0610042I15Rik; 1810013M05Rik; AW105923; prenylated SNARE protein; prenylated SNARE protein (Ykt6); R-SNARE; SNARE protein Ykt6; synaptobrevin homolog YKT6; Ykt6; YKT6 homolog; YKT6 homolog (S. Cerevisiae); YKT6 v-SNARE homolog (S. cerevisiae); YKT6 v-SNARE protein; YKT6, S. cerevisiae, homolog of
Gene	YKT6
Product Type	Antibody
Gene ID (Entrez)	10652
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human YKT6. Recombinant protein control fragment (Product #RP-95596).
Classification	Polyclonal
Primary or Secondary	Primary

2,660

Invitrogen™ Nanog Recombinant Rat Monoclonal Antibody (eBioMLC-51)

Rat Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q80Z64
Isotype	IgG2a κ
Concentration	1 mg/mL
Antigen	Nanog
Gene Symbols	NANOG
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	2410002E02Rik; early embryo specific expression NK family; early embryo specific expression NK-type homeobox protein; Ecat4; ENK; ES cell-associated protein 4; FLJ12581; HGNC:20857; hNanog; Homeobox protein NANOG; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; Nanog; Nanog homeobox
Gene	NANOG
Product Type	Antibody
Gene ID (Entrez)	71950
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	eBioMLC-51

2,661

Invitrogen™ MYH6 Monoclonal Antibody (CL2162)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Liquid
Gene Accession No.	P13533
Isotype	IgG2b
Concentration	1 mg/mL
Antigen	MYH6
Gene Symbols	MYH6
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	A830009F23Rik; AA517445; alpha cardiac MHC; alpha myosin; alpha-MHC; ASD3; cardiac myosin heavy chain alpha isoform; cardiomyopathy, hypertrophic 1; CMD1EE; CMH14; MYH6; MYHC; Myhca; Myhc-a; MyHC-alpha; myosin 6; Myosin heavy chain 6; myosin heavy chain polypeptide 6 cardiac muscle adult; myosin heavy chain, cardiac muscle alpha isoform; Myosin heavy chain, cardiac muscle alpha isoform (MyHC-alpha); myosin heavy chain, cardiac muscle, adult; myosin heavy chain, polypeptide 6, cardiac muscle, alpha; myosin, heavy chain 6, cardiac muscle, alpha; myosin, heavy polypeptide 6, cardiac muscle, alpha; myosin, heavy polypeptide 6, cardiac muscle, alpha (cardiomyopathy, hypertrophic 1); myosin-6; SSS3
Gene	MYH6
Product Type	Antibody
Gene ID (Entrez)	4624
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein fragment of Human MYH6 (Product #RP-89003)
Classification	Monoclonal
Primary or Secondary	Primary
Clone	CL2162

2,662

Invitrogen™ Connexin 36 Recombinant Superclonal™ Antibody (12HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O70610, Q9UKL4
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Connexin 36
Gene Symbols	GJD2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	connexin 36; connexin36; connexin-36; cx36; Gap junction alpha-9 protein; gap junction delta-2 protein; gap junction membrane channel protein alpha 9; gap junction protein delta 2; gap junction protein, alpha 9; gap junction protein, delta 2; gap junction protein, delta 2, 36kDa; GJA10; Gja9; GJD2
Gene	GJD2
Product Type	Antibody
Gene ID (Entrez)	50564, 57369
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptides corresponding to Human GJD2 (aa 288-304, 304-319).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	12HCLC

2,663

Invitrogen™ IL-17A Recombinant Mouse Monoclonal Antibody (eBio64CAP17), Alexa Fluor™ Plus 647

Mouse Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor Plus 647
Applications	Flow Cytometry
Form	Liquid
Gene Accession No.	Q16552
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	IL-17A
Gene Symbols	IL17A
Regulatory Status	RUO
Purification Method	Protein A/G
Gene Alias	Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A
Gene	IL17A
Product Type	Antibody
Gene ID (Entrez)	3605
Formulation	Proprietary buffer with 0.008% Bromonitrodioxane, 0.008% Methylisothiazolone; pH 6.3-7.3
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	eBio64CAP17

2,664

Invitrogen™ CD24 Monoclonal Antibody (M1/69), Functional Grade, eBioscience™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Functional Grade
Applications	Flow Cytometry,Functional Assay
Form	Liquid
Gene Accession No.	P24807
Isotype	IgG2b κ
Concentration	1 mg/mL
Antigen	CD24
Gene Symbols	Cd24a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CD24; CD24 antigen; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 molecule; CD24A; CD24a antigen; cluster of differentiation 24; FLJ22950; FLJ43543; heat stable antigen; heat-stable antigen; HSA; Ly-52; Lymphocyte antigen 52; M1/69-J11D heat stable antigen; MGC75043; Nectadrin; nectadrin heat stable antigen; R13-Ag; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen; X62 heat stable antigen
Gene	Cd24a
Product Type	Antibody
Gene ID (Entrez)	12484
Formulation	PBS with no preservative; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	M1/69

2,665

Invitrogen™ Histone H2A.X Recombinant Rabbit Monoclonal Antibody (1H65L16)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse
Host Species	Rabbit
Conjugate	Unconjugated
Applications	ChIP Assay,Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P16104, P27661
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Histone H2A.X
Gene Symbols	H2AX
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	AW228881; gamma H2AX; gammaH2ax; H2A histone family member X; H2A histone family, member X; H2A.X; H2A.X variant histone; H2A/X; h2afx; H2ax; H2AX histone; Hist5-2ax; histone 5 protein 2ax; histone H2A.x; Histone H2a/x; Histone H2AX; RGD1566119; similar to H2A histone family, member X; zgc:56329
Gene	H2AX
Product Type	Antibody
Gene ID (Entrez)	15270, 3014
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to human H2A.X (aa123-aa142 ).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	1H65L16

2,666

Invitrogen™ Phospho-EGFR (Tyr992) Recombinant Rabbit Monoclonal Antibody (3H24L5)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P00533
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	Phospho-EGFR (Tyr992)
Gene Symbols	EGFR
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2.7.10.1; 9030024J15Rik; AI552599; avian erythroblastic leukemia viral (v-erbB) oncogene homolog; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; EC 2.7.10.1; egf receptor; Egfr; EGFR-related peptide; epidermal growth factor receptor; epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian); Epidermal growth factor receptor formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); epidermal growth factor receptor, formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); ERBB; ERBB1; ErbB-1; erb-b2 receptor tyrosine kinase 1; Errb1; Errp; HER1; kinase EGFR; mENA; NISBD2; Oncogene ERBB; PIG61; Proto-oncogene c-ErbB-1; receptor tyrosine-protein kinase erbB-1; Urogastrone; wa2; wa-2; Wa5; waved 2
Gene	EGFR
Product Type	Antibody
Gene ID (Entrez)	1956
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to Human EGFR (aa 1012-1020).
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	3H24L5

2,667

SOX2 Monoclonal Antibody (Btjce), eFluor™ 570, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Target Species	Human,Mouse
Host Species	Rat
Conjugate	eFluor 570
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P48431, P48432
Gene Symbols	SOX2
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	SOX2
Product Type	Antibody
Gene ID (Entrez)	20674, 6657
Classification	Monoclonal
Primary or Secondary	Primary
Clone	Btjce

2,668

Invitrogen™ HTR2A Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P14842, P28223
Isotype	IgG
Concentration	500 μg/mL
Antigen	HTR2A
Gene Symbols	Htr2a
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A
Gene	Htr2a
Product Type	Antibody
Gene ID (Entrez)	29595, 3356
Formulation	PBS with 5mg BSA and 0.05mg sodium azide
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) .
Classification	Polyclonal
Primary or Secondary	Primary

2,669

Invitrogen™ KLRB1 Monoclonal Antibody (3.2.3)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Rat
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunohistochemistry
Form	Liquid
Gene Accession No.	A4KWA1, P27471, Q0ZUP0
Isotype	IgG1 κ
Concentration	1.0 mg/mL
Antigen	KLRB1
Gene Symbols	Klrb1, Klrb1a, Klrb1b
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	4930431A04Rik; Antigen 3.2.3; CD161; CD161 antigen-like family member A; CD161 antigen-like family member B; CD161a; CD161b; CLEC5B; C-type lectin domain family 5 member B; EMBL:AAQ11375.1}; Gm4696; HNKR-P1a; Immunoreceptor NKR-P1E; immunoreceptor NKR-P1G; inhibitory receptor NKR-P1B; killer cell lectin like receptor B1; killer cell lectin-like receptor subfamily A member 1 complex; killer cell lectin-like receptor subfamily B member 1; killer cell lectin-like receptor subfamily B member 1 complex; killer cell lectin-like receptor subfamily B member 1A; killer cell lectin-like receptor subfamily B member 1B; killer cell lectin-like receptor subfamily B member 1B allele A; Killer cell lectin-like receptor subfamily B member 1B allele B; killer cell lectin-like receptor subfamily B member 1B allele C; killer cell lectin-like receptor subfamily B member 1D; killer cell lectin-like receptor subfamily B member 1F; killer cell lectin-like receptor subfamily B member 1G; killer cell lectin-like receptor subfamily B, member 1; killer cell lectin-like receptor subfamily B, member 1A; Klrb1; Klrb1a; Klrb1b; klrb1b {ECO:0000312; Klrb1d; Klrb1f; Klrb1g; Klrb6; lectin-like transmembrane protein Nkrp1g; Ly55; Ly-55; Ly55a; ly-55A; Ly55b; ly-55b; Ly55d; ly-55d; lymphocyte antigen 55; lymphocyte antigen 55 complex, locus A; lymphocyte antigen 55 complex, locus B; lymphocyte antigen 55 complex, locus D; lymphocyte antigen 55A; lymphocyte antigen 55b; lymphocyte antigen 55d; MGC138614; natural killer cell receptor; natural killer cell receptor protein NKR-P1A; natural killer cell receptor protein NKR-P1B; natural killer cell receptor-P1; natural killer cell surface protein NKR-P1B allele B6; Natural killer cell surface protein NKR-P1B allele RNK/SD/BN/F344; natural killer cell surface protein NKR-P1B allele SJL/BALB; natural killer cell surface protein NKR-P1B allele TO; natural killer cell surface protein NKR-P1G; Natural killer cell surface protein P1-2; natural killer cell surface protein P1-3.2.3; Natural killer cell surface protein P1A; natural killer lectin-like receptor 1E; natural killer lectin-like receptor protein 1 e; NKR; NKR-P1; NKR-P1 2; NKR-P1 3.2.3; NKR-P1 34; NKR-P1.7; NKRP12; NKRP1A; NKR-P1A; Nkrp1-a; Nkrp1b; Nkr-p1b; Nkrp1-b; Nkrp1d; NKR-P1D; Nkrp1e; Nkr-p1e; Nkrp-1e; Nkrp1g; NKR-P1G; RGD:2975}
Gene	Klrb1
Product Type	Antibody
Gene ID (Entrez)	25192, 362443, 689817
Formulation	PBS with no preservative
Immunogen	Rat 24.5 kD cell surface protein known as NKR-P1.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	3.2.3

2,670

CD90.2 (Thy-1.2) Monoclonal Antibody (53-2.1), Super Bright™ 702, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Super Bright 702
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01831
Concentration	0.2 mg/mL
Antigen	CD90.2 (Thy-1.2)
Gene Symbols	Thy1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene	Thy1
Product Type	Antibody
Gene ID (Entrez)	21838
Classification	Monoclonal
Primary or Secondary	Primary
Clone	53-2.1

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ VSIG4 Monoclonal Antibody (NLA14), Alexa Fluor™ 488, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ Phospho-Histone H3 (Ser10) Monoclonal Antibody (3HH3-4C8) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ YKT6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MYH6 Monoclonal Antibody (CL2162) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ CD24 Monoclonal Antibody (M1/69), Functional Grade, eBioscience™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

SOX2 Monoclonal Antibody (Btjce), eFluor™ 570, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ HTR2A Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ KLRB1 Monoclonal Antibody (3.2.3) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD90.2 (Thy-1.2) Monoclonal Antibody (53-2.1), Super Bright™ 702, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ VSIG4 Monoclonal Antibody (NLA14), Alexa Fluor™ 488, eBioscience™

Invitrogen™ Phospho-Histone H3 (Ser10) Monoclonal Antibody (3HH3-4C8)

Invitrogen™ YKT6 Polyclonal Antibody

Invitrogen™ MYH6 Monoclonal Antibody (CL2162)

Invitrogen™ CD24 Monoclonal Antibody (M1/69), Functional Grade, eBioscience™

SOX2 Monoclonal Antibody (Btjce), eFluor™ 570, eBioscience™, Invitrogen™

Invitrogen™ HTR2A Polyclonal Antibody

Invitrogen™ KLRB1 Monoclonal Antibody (3.2.3)

CD90.2 (Thy-1.2) Monoclonal Antibody (53-2.1), Super Bright™ 702, eBioscience™, Invitrogen™